CoraLite® Plus 488-conjugated EIF4E Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-66655

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 EIF4E antibody (CL488-66655, Clone: 3C6B9 ) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-66655

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human EIF4E (CL488-66655, Clone:3C6B9) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL488-66360, Clone: T1F8D3F10) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

EIF4E Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66655

Clone No.3C6B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

3C6B9, eIF 4E, eIF-4E, EIF4EL1, EIF4F

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66655 targets EIF4E in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27191

  Product name: Recombinant human EIF4E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-217 aa of BC012611

  Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

• Full Name: eukaryotic translation initiation factor 4E
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC012611
• Gene Symbol: EIF4E
• Gene ID (NCBI): 1977
• RRID: AB_2883364
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P06730
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins.