Tested Applications
| Positive WB detected in | human blood tissue, HepG2 cells, human blood, human red blood cells |
| Positive IHC detected in | human spleen tissue, human colon tissue, human stomach cancer tissue, human colon cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67014-1-Ig targets ICAM4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27628 Product name: Recombinant human ICAM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-152 aa of BC029364 Sequence: ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR Predict reactive species |
| Full Name | intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) |
| Calculated Molecular Weight | 271 aa, 29 kDa |
| Observed Molecular Weight | 38-42 kDa |
| GenBank Accession Number | BC029364 |
| Gene Symbol | ICAM4 |
| Gene ID (NCBI) | 3386 |
| RRID | AB_2882330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14773 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. The protein migrate as a 42 kDa glycoprotein on SDS PAGE. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ICAM4 antibody 67014-1-Ig | Download protocol |
| IHC protocol for ICAM4 antibody 67014-1-Ig | Download protocol |
| WB protocol for ICAM4 antibody 67014-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ICAM4 Monoclonal antibody (3A9B9), catalog number 67014-1-Ig, has 1 total citation. It appears in the Journal of Clinical Endocrinology & Metabolism (IF 5.4). The cited study investigates the lncRNA LPAL2/miR-1287-5p/EGFR axis in thyroid eye disease–derived orbital fibroblast activation via cell adhesion factors, placing this citation in the fields of endocrinology, thyroid disease, and cell adhesion biology. The application used was Western blot in human samples.
| Species | Application | Title |
|---|---|---|
J Clin Endocrinol Metab LncRNA LPAL2/miR-1287-5p/EGFR axis modulates TED derived orbital fibroblast activation through cell adhesion factors. |
