Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 555-conjugated 14-3-3 Polyclonal antibody

14-3-3 Polyclonal Antibody for FC (Intra)

Cat No. CL555-14503

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

YWHAQ, 14-3-3 protein T-cell, 14-3-3 theta, 14-3-3 zeta, 14-3-3σ

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-14503 targets 14-3-3 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5959

Product name: Recombinant human 14-3-3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC056867

Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC056867
Gene Symbol 14-3-3 theta
Gene ID (NCBI) 10971
RRIDAB_2934637
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
Excitation LaserGreen Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27348
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

14-3-3 proteins are the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 555 14-3-3 antibody CL555-14503Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...