• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated 14-3-3 Polyclonal antibody

14-3-3 Polyclonal Antibody for FC (Intra)
Cat No. CL647-14503

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

14 3 3, 14 3 3 protein T cell, 14 3 3 protein tau, 14 3 3 protein theta, 14-3-3, 1C5, HS1, Protein HS1, YWHAQ

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-14503 targets 14-3-3 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5959

Product name: Recombinant human 14-3-3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC056867

Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC056867
Gene Symbol 14-3-3 theta
Gene ID (NCBI) 10971
RRIDAB_2934897
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27348
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

14-3-3 proteins are the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 14-3-3 antibody CL647-14503Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...