CoraLite® Plus 488-conjugated ARF1 Monoclonal antibody

ARF1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68069
Clone No.1C10E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

IF/ICC, FC (Intra)

1C10E3, ADP ribosylation factor 1, ADP-ribosylation factor 1, EC:3.6.5.2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68069 targets ARF1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, rabbit samples.

Tested Reactivity human, mouse, rat, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28021

Product name: Recombinant human ARF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-181 aa of BC009247

Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Predict reactive species
Full Name ADP-ribosylation factor 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 18-21 kDa
GenBank Accession NumberBC009247
Gene Symbol ARF1
Gene ID (NCBI) 375
RRIDAB_2919562
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP84077
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment.(PMID: 7759471, PMID: 16042562).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ARF1 antibody CL488-68069Download protocol
IF protocol for CL Plus 488 ARF1 antibody CL488-68069Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...