CoraLite® Plus 488-conjugated ARHGEF16 Monoclonal antibody

ARHGEF16 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67975
Clone No.1D8E3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, FC (Intra)

1D8E3, Ephexin 4, EPHEXIN4, Ephexin-4, GEF16

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67975 targets ARHGEF16 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28675

Product name: Recombinant human ARHGEF16 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-421 aa of BC002681

Sequence: MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

Predict reactive species
Full Name Rho guanine exchange factor (GEF) 16
Calculated Molecular Weight 80 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC002681
Gene Symbol ARHGEF16
Gene ID (NCBI) 27237
RRIDAB_2934603
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5VV41
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Small GTPases of the Rho family are critical regulators of various cellular functions including actin cytoskeleton organization, activation of kinase cascades, mitogenesis, transcriptional activation and stimulation of DNA synthesis. Rho proteins cycle between a biologically active GTP-bound state and an inactive GDP-bound state. Rho guanine nucleotide exchange factor (GEF) has a crucial role in activating small GTPase by exchange GDP for GTP. ARGEF16 is one of the multiple GEF members. Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ARHGEF16 antibody CL488-67975Download protocol
IF protocol for CL Plus 488 ARHGEF16 antibody CL488-67975Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...