CoraLite®555-conjugated ARHGEF16 Monoclonal antibody

ARHGEF16 Monoclonal Antibody for FC (Intra)
Cat No. CL555-67975
Clone No.1D8E3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

FC (Intra)

NBR, GEF16, Ephexin-4, EPHEXIN4, Ephexin 4

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67975 targets ARHGEF16 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28675

Product name: Recombinant human ARHGEF16 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-421 aa of BC002681

Sequence: MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

Predict reactive species
Full Name Rho guanine exchange factor (GEF) 16
Calculated Molecular Weight 80 kDa
Observed Molecular Weight80 kDa
GenBank Accession NumberBC002681
Gene Symbol ARHGEF16
Gene ID (NCBI) 27237
RRIDAB_3084634
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5VV41
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Small GTPases of the Rho family are critical regulators of various cellular functions including actin cytoskeleton organization, activation of kinase cascades, mitogenesis, transcriptional activation and stimulation of DNA synthesis. Rho proteins cycle between a biologically active GTP-bound state and an inactive GDP-bound state. Rho guanine nucleotide exchange factor (GEF) has a crucial role in activating small GTPase by exchange GDP for GTP. ARGEF16 is one of the multiple GEF members. Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions.

Protocols

Product Specific Protocols
FC protocol for CL555 ARHGEF16 antibody CL555-67975Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...