CoraLite® Plus 488-conjugated ARL8A/ARL8B Monoclonal antibody

• 

  IF Staining of HEK-293 using CL488-68186

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite® Plus 488 ARL8A/ARL8B antibody (CL488-68186, Clone: 2F4C3 ) at dilution of 1:200.

• 

  IF Staining of A549 using CL488-68186

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite® Plus 488 ARL8A/ARL8B antibody (CL488-68186, Clone: 2F4C3 ) at dilution of 1:200.

• 

  IF Staining of Neuro-2a using CL488-68186

  Immunofluorescent analysis of (-20°C Ethanol) fixed Neuro-2a cells using CoraLite® Plus 488 ARL8A/ARL8B antibody (CL488-68186, Clone: 2F4C3 ) at dilution of 1:200.

• 

  FC experiment of C6 using CL488-68186

  1x10^6 C6 cells were intracellularly stained with 0.4 ug Coralite® Plus 488 Arl8a/Arl8b Monoclonal Antibody (CL488-68186, Clone:2F4C3)(red), or 0.4 ug Isotype Control (CL488-66360-2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

ARL8A/ARL8B Monoclonal Antibody for IF/ICC

Cat No. CL488-68186

Clone No.2F4C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, rabbit

Applications

IF/ICC

Synonyms

ARL8A, 2F4C3, ADP-ribosylation factor-like protein 10B, ADP-ribosylation factor-like protein 8A, ARL10B

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells, Neuro-2a cells, A549 cells
• Positive FC (Intra) detected in: C6 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68186 targets ARL8A/ARL8B in IF/ICC applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10758

  Product name: Recombinant human ARL8A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-186 aa of BC015408

  Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

• Full Name: ADP-ribosylation factor-like 8A
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 18 kDa, 21 kDa
• GenBank Accession Number: BC015408
• Gene Symbol: ARL8A
• Gene ID (NCBI): 127829
• RRID: AB_3672977
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96BM9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ARL8A (ADP-ribosylation factor-like protein 8A) is also named as ARL10B, GIE2 and belongs to the small GTPase superfamily. ARL8A is localized to lysosomes in mammalian cells (PMID: 16537643). In neurons, ARL8A mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles that are required for presynaptic biogenesis and synaptic function. ARL8A is upregulated in many cancers such as endometrial cancer (PMID: 32070877), colorectal cancer (PMID: 30546056) and inflammatory breast cancer (PMID: 27648361), and has been associated with poor survival outcomes. ARL8A/ARL8B can be recognized by this antibody.