CoraLite® Plus 488-conjugated ARL8A/ARL8B Monoclonal antibody

ARL8A/ARL8B Monoclonal Antibody for IF/ICC
Cat No. CL488-68186
Clone No.2F4C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, rabbit

Applications

IF/ICC

ARL8A, 2F4C3, ADP-ribosylation factor-like protein 10B, ADP-ribosylation factor-like protein 8A, ARL10B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells, Neuro-2a cells, A549 cells
Positive FC (Intra) detected inC6 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68186 targets ARL8A/ARL8B in IF/ICC applications and shows reactivity with human, mouse, rat, rabbit samples.

Tested Reactivity human, mouse, rat, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10758

Product name: Recombinant human ARL8A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-186 aa of BC015408

Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Predict reactive species
Full Name ADP-ribosylation factor-like 8A
Calculated Molecular Weight 186 aa, 21 kDa
Observed Molecular Weight18 kDa, 21 kDa
GenBank Accession NumberBC015408
Gene Symbol ARL8A
Gene ID (NCBI) 127829
RRIDAB_3672977
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96BM9
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ARL8A (ADP-ribosylation factor-like protein 8A) is also named as ARL10B, GIE2 and belongs to the small GTPase superfamily. ARL8A is localized to lysosomes in mammalian cells (PMID: 16537643). In neurons, ARL8A mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles that are required for presynaptic biogenesis and synaptic function. ARL8A is upregulated in many cancers such as endometrial cancer (PMID: 32070877), colorectal cancer (PMID: 30546056) and inflammatory breast cancer (PMID: 27648361), and has been associated with poor survival outcomes. ARL8A/ARL8B can be recognized by this antibody.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ARL8A/ARL8B antibody CL488-68186Download protocol
IF protocol for CL Plus 488 ARL8A/ARL8B antibody CL488-68186Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...