• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Annexin V Monoclonal antibody

Annexin V Monoclonal Antibody for IF/ICC
Cat No. CL488-66245
Clone No.1E6A8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Anchorin CII, Annexin 5, annexin A5, Annexin V, ANX5, ANXA5, Calphobindin I, CBP I, Endonexin II, ENX2, Lipocortin V, PAP I, PP4, Thromboplastin inhibitor, VAC alpha, Vascular anticoagulant alpha

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66245 targets Annexin V in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1538

Product name: Recombinant human ANXA5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-320 aa of BC001429

Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Predict reactive species
Full Name annexin A5
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC001429
Gene Symbol Annexin V
Gene ID (NCBI) 308
RRIDAB_3084224
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08758
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. This antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Annexin V antibody CL488-66245Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...