CoraLite® Plus 647-conjugated Annexin V Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647-conjugated Annexin V Monoclonal antibody (CL647-66245)

• Featured Product
• KD/KO Validated

Annexin V Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL647-66245 Copied!

Clone No. 1E6A8

Publications (3)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

• 

  IF Staining of HeLa using CL647-66245

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 647 Annexin V antibody (CL647-66245, Clone: 1E6A8 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using CL647-66245

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 647 Anti-Human Annexin V (CL647-66245, Clone:1E6A8) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Annexin V in ?

Chat with Able

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66245 targets Annexin V in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1538

  Product name: Recombinant human ANXA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC001429

  Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

• Full Name: annexin A5
• Calculated Molecular Weight: 36 kDa
• GenBank Accession Number: BC001429
• Gene Symbol: Annexin V
• Gene ID (NCBI): 308
• RRID: AB_2920278
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08758
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Publications

What published studies show

CoraLite® Plus 647-conjugated Annexin V Monoclonal antibody (CL647-66245) has 3 citations. They appear in Cell, STAR Protoc, and bioRxiv. The research fields span autoimmune kidney disease and podocyte membrane dynamics, extracellular vesicle isolation from nephrotic urine, and Plasmodium falciparum cytoadhesion involving the endothelial glycocalyx.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse		Cell; Autoantibody-triggered podocyte membrane budding drives autoimmune kidney disease.; Authors - Karen Lahme
		STAR Protoc; Protocol for isolating human extracellular vesicles from nephrotic urine and enriching autoimmunoglobulin-triggered extracellular vesicles.; Authors - Karen Lahme
human		bioRxiv; Febrile temperature enhances Plasmodium falciparum cytoadhesion by disrupting the endothelial glycocalyx; Authors - Viola Introini