• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated Annexin V Monoclonal antibody

Annexin V Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-66245
Clone No.1E6A8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Annexin A5, ANXA5, Anchorin CII, Annexin 5, Annexin-5

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66245 targets Annexin V in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1538

Product name: Recombinant human ANXA5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-320 aa of BC001429

Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Predict reactive species
Full Name annexin A5
Calculated Molecular Weight 36 kDa
GenBank Accession NumberBC001429
Gene Symbol Annexin V
Gene ID (NCBI) 308
RRIDAB_2920278
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08758
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 Annexin V antibody CL647-66245Download protocol
FC protocol for CL Plus 647 Annexin V antibody CL647-66245Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...