• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated EIF4E Polyclonal antibody

EIF4E Polyclonal Antibody for FC (Intra)
Cat No. CL647-11149

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

mRNA cap-binding protein, eIF-4F 25 kDa subunit, EIF4F, EIF4EL1, eIF-4E

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-11149 targets EIF4E in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1626

Product name: Recombinant human EIF4E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-217 aa of BC012611

Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

Predict reactive species
Full Name eukaryotic translation initiation factor 4E
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 26-29 kDa, 50 kDa
GenBank Accession NumberBC012611
Gene Symbol EIF4E
Gene ID (NCBI) 1977
RRIDAB_2934847
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06730
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 EIF4E antibody CL647-11149Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...