CoraLite® Plus 647-conjugated EIF4E Polyclonal antibody

• 

  FC experiment of HepG2 using CL647-11149

  1X10^6 HepG2 cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human EIF4E (CL647-11149) (red), or 0.2 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

EIF4E Polyclonal Antibody for FC (Intra)

Cat No. CL647-11149

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

eIF 4E, eIF-4E, EIF4EL1, EIF4F, eIF-4F 25 kDa subunit

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-11149 targets EIF4E in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1626

  Product name: Recombinant human EIF4E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC012611

  Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV

• Full Name: eukaryotic translation initiation factor 4E
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 26-29 kDa, 50 kDa
• GenBank Accession Number: BC012611
• Gene Symbol: EIF4E
• Gene ID (NCBI): 1977
• RRID: AB_2934847
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06730
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins.