CoraLite® Plus 488-conjugated CRMP2 Polyclonal antibody

CRMP2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-14686

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

DPYSL2, CRMP-2, DHPRP2, Dihydropyrimidinase-related protein 2, DRP2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14686 targets CRMP2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5985

Product name: Recombinant human DPYSL2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 223-572 aa of BC056408

Sequence: HVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

Predict reactive species
Full Name dihydropyrimidinase-like 2
Calculated Molecular Weight 62 kDa
Observed Molecular Weight 62-66 kDa
GenBank Accession NumberBC056408
Gene Symbol CRMP2
Gene ID (NCBI) 1808
RRIDAB_3672599
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16555
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Dihydropyrimidinase-like 2 (Dpysl2), a protein involved in neuronal differentiation and axonal guidance is found altered in various nervous system diseases (PMID:19524114). It is also named as CRMP2, ULIP2 and belongs to hydantoinase/dihydropyrimidinase subfamily. The phosphorylation of the particular portion carboxyl-terminal to the basic region of DPYSL2 may play an important role in regulating its activity, and may be involved in the formation of degenerating neurites in AD brain(PMID:10757975).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CRMP2 antibody CL488-14686Download protocol
IF protocol for CL Plus 488 CRMP2 antibody CL488-14686Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...