• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated CTP synthase Polyclonal antibody

CTP synthase Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-15914

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

CTPS, CTPS 1, CTPS1, EC:6.3.4.2, UTP--ammonia ligase 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-15914 targets CTP synthase in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8707

Product name: Recombinant human CTPS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 242-591 aa of BC009408

Sequence: ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD

Predict reactive species
Full Name CTP synthase
Calculated Molecular Weight 591 aa, 67 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC009408
Gene Symbol CTPS
Gene ID (NCBI) 1503
RRIDAB_2919826
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17812
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CTP synthase(CTPS) is also named as CTPS1 and belongs to the CTP synthase family. It catalyses the ATP-dependent formation of CTP from UTP using either L-glutamine or NH3 as the nitrogen source(PMID:12752439). It is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis (PMID:8813694). CTP synthetase exists as a dimer in the absence of its substrates ATP and UTP, but in the presence of saturating concentrations of these substrates the enzyme exists as a tetramer.(PMID:18439916)

Protocols

Product Specific Protocols
FC protocol for CL594 CTP synthase antibody CL594-15914Download protocol
IF protocol for CL594 CTP synthase antibody CL594-15914Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...