Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated Cyclin E2 Polyclonal antibody

Cyclin E2 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-11935

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

CCNE2, G1/S-specific cyclin-E2, G1/S specific cyclin E2, Cyclin E, CYCE2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11935 targets Cyclin E2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2532

Product name: Recombinant human CCNE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-374 aa of BC020729

Sequence: MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLCMISSHV

Predict reactive species
Full Name cyclin E2
Calculated Molecular Weight 374 aa, 44 kDa
GenBank Accession NumberBC020729
Gene Symbol CCNE2
Gene ID (NCBI) 9134
RRIDAB_2919044
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO96020
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cyclin E2 (CCNE2) belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of cyclindependent kinases (CDKs). Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of cell cycle events. CCNE2 forms a complex with and functions as a regulatory subunit of CDK2 and has been shown to specifically interact with CIP/KIP family of CDK inhibitors. CCNE2 plays a role in cell cycle G1/S transition and its expression peaks at the G1-S phase. Whereas cyclin E1 is expressed in most proliferating normal and tumor cells, cyclin E2 levels are low or undetectable in nontransformed cells, and are elevated in tumor-derived cells.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Cyclin E2 antibody CL488-11935Download protocol
IF protocol for CL Plus 488 Cyclin E2 antibody CL488-11935Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...