CoraLite®555-conjugated Cyclin E2 Polyclonal antibody

Cyclin E2 Polyclonal Antibody for IF/ICC
Cat No. CL555-11935

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CCNE2, G1/S-specific cyclin-E2, G1/S specific cyclin E2, Cyclin E, CYCE2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-11935 targets Cyclin E2 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2532

Product name: Recombinant human CCNE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-374 aa of BC020729

Sequence: MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLCMISSHV

Predict reactive species
Full Name cyclin E2
Calculated Molecular Weight 374 aa, 44 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC020729
Gene Symbol CCNE2
Gene ID (NCBI) 9134
RRIDAB_2919607
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO96020
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cyclin E2 (CCNE2) belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of cyclindependent kinases (CDKs). Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of cell cycle events. CCNE2 forms a complex with and functions as a regulatory subunit of CDK2 and has been shown to specifically interact with CIP/KIP family of CDK inhibitors. CCNE2 plays a role in cell cycle G1/S transition and its expression peaks at the G1-S phase. Whereas cyclin E1 is expressed in most proliferating normal and tumor cells, cyclin E2 levels are low or undetectable in nontransformed cells, and are elevated in tumor-derived cells.

Protocols

Product Specific Protocols
IF protocol for CL555 Cyclin E2 antibody CL555-11935Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...