CoraLite®594-conjugated Cytoglobin Monoclonal antibody

• 

  IF Staining of HeLa using CL594-60228

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 Cytoglobin antibody (CL594-60228, Clone: 4C7E11 ) at dilution of 1:200, CL488-Phalloidin (green).

• 

  IF Staining of HeLa using CL594-60228

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 Cytoglobin antibody (CL594-60228, Clone: 4C7E11 ) at dilution of 1:200.

• 

  IF Staining of HeLa using CL594-60228

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 Cytoglobin antibody (CL594-60228, Clone: 4C7E11 ) at dilution of 1:200.

Cytoglobin Monoclonal Antibody for IF/ICC

Cat No. CL594-60228

Clone No.4C7E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

Synonyms

CYGB, 4C7E11, EC:1.11.1.-, EC:1.14.12.-, EC:1.15.1.1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60228 targets Cytoglobin in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4161

  Product name: Recombinant human CYGB protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-190 aa of BC029798

  Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

• Full Name: cytoglobin
• Calculated Molecular Weight: 190 aa, 21 kDa
• Observed Molecular Weight: 27-29 kDa
• GenBank Accession Number: BC029798
• Gene Symbol: Cytoglobin
• Gene ID (NCBI): 114757
• RRID: AB_2883446
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8WWM9
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kDa, runs as a 29kd one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.