CoraLite® Plus 647-conjugated Cytokeratin 14 Polyclonal antibody

• 

  FC experiment of A431 using CL647-10143

  1x10^6 A431 cells were intracellularly stained with 0.8 ug CoraLite® Plus 647 Anti-Human Cytokeratin 14 (CL647-10143)(red), or 0.8 ug CoraLite® Plus 647-conjugated Rabbit IgG control Rabbit PolyAb (CL647-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Cytokeratin 14 Polyclonal Antibody for FC (Intra)

Cat No. CL647-10143

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

Cell and organelle markers, CK 14, CK14, Cytokeratin 14, Cytoskeleton Marker, EBS3, EBS4, K14, keratin 14, KRT14, NFJ

---

Tested Applications

• Positive FC (Intra) detected in: A431 cells
• Positive FC detected in: A431 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10143 targets Cytokeratin 14 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0188

  Product name: Recombinant human KRT14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 262-472 aa of BC002690

  Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

• Full Name: keratin 14
• Calculated Molecular Weight: 472 aa, 52 kDa
• Observed Molecular Weight: 47-50 kDa
• GenBank Accession Number: BC002690
• Gene Symbol: Cytokeratin 14
• Gene ID (NCBI): 3861
• RRID: AB_2934808
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02533
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	FC (Intra)	Int J Mol Sci; A Truncated Mutation of TP53 Promotes Chemoresistance in Tongue Squamous Cell Carcinoma; Authors - Xiaoyun Du