CoraLite® Plus 647-conjugated Cytokeratin 6A Polyclonal antibody

Cytokeratin 6A Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-10590

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

CK 6A, CK 6D, CK6A, CK6C, CK6D, Cytokeratin 6A, Cytokeratin 6D, Hom s 5, K6A, K6C, K6D, keratin 6A, KRT conserve, KRT6, KRT6A, KRT6C, KRT6D, Type II keratin Kb6

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells
Positive FC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10590 targets Cytokeratin 6A in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0882

Product name: Recombinant human KRT6A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 364-564 aa of BC008807

Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

Predict reactive species
Full Name keratin 6A
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC008807
Gene Symbol Cytokeratin 6A
Gene ID (NCBI) 3853
RRIDAB_2934826
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02538
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as marker for epidermal hyperproliferation and differentiation. Three are three keratin 6 isoforms: ketatin 6A,6B and 6C. They share more than 99% identical DNA sequence.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 Cytokeratin 6A antibody CL647-10590Download protocol
FC protocol for CL Plus 647 Cytokeratin 6A antibody CL647-10590Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...