CoraLite® Plus 488-conjugated Cytokeratin 6A Polyclonal antibody

• 

  IF Staining of A431 using CL488-10590

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CoraLite® Plus 488 Cytokeratin 6A antibody (CL488-10590) at dilution of 1:200.

• 

  FC experiment of A431 using CL488-10590

  1X10^6 A431 cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human Cytokeratin 6A (CL488-10590) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Cytokeratin 6A Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10590

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

CK 6A, CK 6D, CK6A, CK6C, CK6D, Cytokeratin 6A, Cytokeratin 6D, Hom s 5, K6A, K6C, K6D, keratin 6A, KRT conserve, KRT6, KRT6A, KRT6C, KRT6D, Type II keratin Kb6

---

Tested Applications

• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: A431 cells
• Positive FC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10590 targets Cytokeratin 6A in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0882

  Product name: Recombinant human KRT6A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 364-564 aa of BC008807

  Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

• Full Name: keratin 6A
• Calculated Molecular Weight: 60 kDa
• GenBank Accession Number: BC008807
• Gene Symbol: Cytokeratin 6A
• Gene ID (NCBI): 3853
• RRID: AB_2918987
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02538
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as marker for epidermal hyperproliferation and differentiation. Three are three keratin 6 isoforms: ketatin 6A,6B and 6C. They share more than 99% identical DNA sequence.