CoraLite® Plus 647-conjugated DNAJB1 Polyclonal antibody

• 

  IF Staining of HeLa using CL647-13174

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 647 DNAJB1 antibody (CL647-13174) at dilution of 1:200.

• 

  FC experiment of HeLa using CL647-13174

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human DNAJB1 (CL647-13174) (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

DNAJB1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL647-13174

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

Heat shock 40 kDa protein 1, hDj-1, Hdj1, hDj 1, DNAJ1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-13174 targets DNAJB1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3830

  Product name: Recombinant human DNAJB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-340 aa of BC019827

  Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

• Full Name: DnaJ (Hsp40) homolog, subfamily B, member 1
• Calculated Molecular Weight: 340 aa, 40 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC019827
• Gene Symbol: DNAJB1
• Gene ID (NCBI): 3337
• RRID: AB_2934880
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P25685
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DNAJB1 is a member of the heat shock 40 protein family and has been involved in a variety of cellular processes, including the proteasome pathway, endoplasmic reticulum stress and viral infection. DNAJB1-PRKACA gene fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma.