CoraLite® Plus 647-conjugated DRP1 (N-terminal) Polyclonal antibody

DRP1 (N-terminal) Polyclonal Antibody for FC (Intra)
Cat No. CL647-26187

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

DRP1, Dymple, Dnm1p/Vps1p-like protein, DNM1L,DLP1, DNM1L

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-26187 targets DRP1 (N-terminal) in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24249

Product name: Recombinant human DNM1L,DLP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 69-142 aa of BC024590

Sequence: HVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNL

Predict reactive species
Full Name dynamin 1-like
Calculated Molecular Weight 736 aa, 82 kDa
Observed Molecular Weight 70-78 kDa
GenBank Accession NumberBC024590
Gene Symbol DRP1
Gene ID (NCBI) 10059
RRIDAB_2934960
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00429
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DNM1L(Dynamin-1-like protein) , also known as dynamin-related protein 1 (DRP1), belongs to the dynamin family of large GTPases that mediate membrane remodeling during a variety of cellular processes. DNM1L has an important role in the division of growing mitochondria and peroxisomes and also mediates outer mitochondrial membrane fission in mammalian cells. DNM1L is ubiquitously expressed with abundant expression in skeletal muscle, heart, kidney and brain.Variable isoforms of DNM1L have been reported in a tissue-specific manner due to the alternative splicing.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 DRP1 (N-terminal) antibody CL647-26187Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...