• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Fibronectin Monoclonal antibody

Fibronectin Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)
Cat No. CL594-66042
Clone No.1G10F9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P, FC (Intra)

FN1, 1G10F9, Anastellin, CIG, Cold insoluble globulin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman colon cancer tissue
Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66042 targets Fibronectin in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8016

Product name: Recombinant human FN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2177-2386 aa of BC005858

Sequence: DQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Predict reactive species
Full Name fibronectin 1
Calculated Molecular Weight 2386 aa, 263 kDa
Observed Molecular Weight 263 kDa
GenBank Accession NumberBC005858
Gene Symbol Fibronectin
Gene ID (NCBI) 2335
RRIDAB_2883488
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02751
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Fibronectin 1 (FN1) is a high molecular weight glycoprotein which exists in both a soluble form in plasma (plasma FN1) and other body fluids and an insoluble form in the extracellular matrix (cellular FN1). Plasma FN1 (dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and other cell types, is deposited as fibrils in the extracellular matrix. FN1 binds to cell surfaces through integrins and to various compounds including collagen, fibrin and heparin. It is involved in cell adhesion and migration processes including embryogenesis, wound healing, hemostasis, host defense, and metastasis. (PMID: 7276612; 12244123; 12847088)

Protocols

Product Specific Protocols
FC protocol for CL594 Fibronectin antibody CL594-66042Download protocol
IF protocol for CL594 Fibronectin antibody CL594-66042Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...