CoraLite® Plus 488-conjugated GREM2 Polyclonal antibody

• 

  IF Staining of mouse kidney using CL488-13892

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using CoraLite® Plus 488 GREM2 antibody (CL488-13892) at dilution of 1:200.

• 

  FC experiment of HCT 116 using CL488-13892

  1X10^6 HCT 116 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human GREM2 (CL488-13892) (red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

GREM2 Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-13892

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

Synonyms

Gremlin2, Gremlin 2, GREM 2, DAND3, DAND 3

---

Tested Applications

• Positive IF-P detected in: mouse kidney tissue
• Positive FC (Intra) detected in: HCT 116 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13892 targets GREM2 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4854

  Product name: Recombinant human GREM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-168 aa of BC046632

  Sequence: AIHSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ

• Full Name: gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis)
• Calculated Molecular Weight: 168 aa, 19 kDa
• GenBank Accession Number: BC046632
• Gene Symbol: GREM2
• Gene ID (NCBI): 64388
• RRID: AB_3083948
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H772
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.