• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated Glutamine Synthetase Monoclonal antibody

Glutamine Synthetase Monoclonal Antibody for IF
Cat No. CL555-66323
Clone No.1B6G4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF

GLNS, GLUL, Glutamate ammonia ligase, Glutamate decarboxylase, Glutamine synthetase, GS, PIG43, PIG59

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL555-66323 targets Glutamine Synthetase in IF applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6309

Product name: Recombinant human Glutamine synthetase protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-373 aa of BC011700

Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Predict reactive species
Full Name glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight42 kDa
GenBank Accession NumberBC011700
Gene Symbol Glutamine Synthetase
Gene ID (NCBI) 2752
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP15104
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GLUL(Glutamine synthetase) is also named as GS, GLNS, which belongs to the glutamine synthetase family. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for the proliferation of fetal skin fibroblasts(PMID:18662667). Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD). Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).

Protocols

Product Specific Protocols
IF protocol for CL555 Glutamine Synthetase antibody CL555-66323Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...