Human IgA Heavy Chain Polyclonal antibody

Human IgA Heavy Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 11449-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Human IgA, IGHA1, IgA, IgA1, Igh2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma tissue, human lung tissue
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11449-1-AP targets Human IgA Heavy Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2007

Product name: Recombinant human Human IgA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-353 aa of BC016369

Sequence: TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

Predict reactive species
Full Name immunoglobulin heavy constant alpha 1
Calculated Molecular Weight 496 aa, 53 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC016369
Gene Symbol Human IgA Heavy Chain
Gene ID (NCBI) 3493
RRIDAB_833092
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. This antibody recognizes the Chain C region of human Ig alpha-1 (IGHA1).

Protocols

Product Specific Protocols
FC protocol for Human IgA Heavy Chain antibody 11449-1-APDownload protocol
IF protocol for Human IgA Heavy Chain antibody 11449-1-APDownload protocol
IHC protocol for Human IgA Heavy Chain antibody 11449-1-APDownload protocol
WB protocol for Human IgA Heavy Chain antibody 11449-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Infect

Immune responses and residual SARS-CoV-2 in two critically ill COVID-19 patients before and after lung transplantation.

Authors - Yan Yan
WB

Cell Immunol

Mesenchymal stem cell transplantation worsens intestinal inflammation and microenvironment in PI3Kγ-knockout mice

Authors - Yi Li
humanWB

Sci Rep

Natural antibodies and CRP drive anaphylatoxin production by urate crystals.

Authors - Anne Kathrin Wessig
humanWB

Sci Rep

A prospective study revealing the role of an immune-related eRNA, WAKMAR2, in breast cancer

Authors - LinbangWang
mouseWB

Int Immunopharmacol

Altered microbial community structure in PI3Kγ knockout mice with colitis impeding relief of inflammation: Establishment of new indices for intestinal microbial disorder.

Authors - Yi Li
IHC

Evid Based Complement Alternat Med

Calycosin Improves Intestinal Mucosal Barrier Function after Gastrectomy in Rats through Alleviating Bacterial Translocation, Inflammation, and Oxidative Stress.

Authors - Hui Peng
Loading...
||
New chat Able
正在加载,请稍候...