Human IgA Heavy Chain Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Human IgA Heavy Chain Polyclonal antibody (11449-1-AP)

Human IgA Heavy Chain Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 11449-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

Human IgA, IGHA1, IgA, IgA1, Igh2

• 

  WB analysis of human plasma using 11449-1-AP

  human plasma (0.3 ug) were subjected to SDS PAGE followed by western blot with 11449-1-AP (Human IgA Heavy Chain antibody at dilution of 1:1000. (1 Sec exposure) incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human lung using 11449-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11449-1-AP (IGHA1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11449-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11449-1-AP (Human IgA Heavy Chain antibody) at dilution of 1:10000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11449-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11449-1-AP (Human IgA Heavy Chain antibody) at dilution of 1:10000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 11449-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11449-1-AP (Human IgA Heavy Chain antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 11449-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using Human IgA Heavy Chain antibody (11449-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Ramos using 11449-1-AP

  1x10^6 Ramos cells were intracellularly stained with 0.4 ug Human IgA Heavy Chain Polyclonal antibody (11449-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Human IgA Heavy Chain in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human plasma tissue, human lung tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue
• Positive FC (Intra) detected in: Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:5000-1:20000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11449-1-AP targets Human IgA Heavy Chain in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2007

  Product name: Recombinant human Human IgA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-353 aa of BC016369

  Sequence: TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

• Full Name: Human IgA Heavy Chain
• Calculated Molecular Weight: 496 aa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC016369
• RRID: AB_833092
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. This antibody recognizes the Chain C region of human Ig alpha-1 (IGHA1).

Publications

What published studies show

Human IgA Heavy Chain polyclonal antibody (Cat# 11449-1-AP) has 24 citations across journals including Cancer Cell, EMBO Molecular Medicine, International Journal of Biological Macromolecules, Scientific Reports, Journal of Infectious Diseases, Ocular Surface, and Veterinary Research. Research fields encompass immunology, oncology (colorectal, breast, hepatocellular cancers), infectious disease (SARS-CoV-2), intestinal mucosal immunity, IgA nephropathy, veterinary medicine, and food science.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cancer Cell; CCL19-producing fibroblasts promote tertiary lymphoid structure formation enhancing anti-tumor IgG response in colorectal cancer liver metastasis; Authors - Yifan Zhang
human	IHC	J Infect; Immune responses and residual SARS-CoV-2 in two critically ill COVID-19 patients before and after lung transplantation.; Authors - Yan Yan
human	WB	J Transl Med; A dynamic molecular landscape in colorectal cancer progression at single-cell resolution; Authors - Jianwen Sheng
mouse	IF	Int J Biol Macromol; Rehmannia glutinosa polysaccharides alleviate cyclophosphamide-induced immunosuppression by enhancing immunity and restoring intestinal homeostasis; Authors - Lin Yu
		Int J Biol Macromol; Insights into the relationship between the acetylation of Dendrobium officinale polysaccharides and the ability to promote sIgA secretion; Authors - Wenlei Nie
mouse	IF	Int J Biol Macromol; Rehmannia glutinosa polysaccharides enhance intestinal immunity of mice through regulating the microbiota; Authors - Lin Yu