CoraLite®594-conjugated IgA Heavy Chain Polyclonal antibody

Human IgA Heavy Chain Polyclonal Antibody for IF-P
Cat No. CL594-11449

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

FLJ14473, FLJ35065, FLJ35500, FLJ36402, FLJ39698, FLJ40001, FLJ41548, FLJ41552, FLJ41789, FLJ43248, FLJ43594, FLJ44293, FLJ46028, FLJ46621, FLJ46724, FLJ46811, FLJ46824, FLJ90170, IgA1, IGHA1

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-11449 targets Human IgA Heavy Chain in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2007

Product name: Recombinant human Human IgA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-353 aa of BC016369

Sequence: TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

Predict reactive species
Full Name immunoglobulin heavy constant alpha 1
Calculated Molecular Weight 496 aa, 53 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC016369
Gene Symbol Human IgA Heavy Chain
Gene ID (NCBI) 3493
RRIDAB_2919764
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. This antibody recognizes the Chain C region of human Ig alpha-1 (IGHA1).

Protocols

Product Specific Protocols
IF protocol for CL594 Human IgA Heavy Chain antibody CL594-11449Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...