• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RABL3 Polyclonal antibody

RABL3 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11916

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Rab like protein 3, Rab-like protein 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11916 targets RABL3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2531

Product name: Recombinant human RABL3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of BC020832

Sequence: MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD

Predict reactive species
Full Name RAB, member of RAS oncogene family-like 3
Calculated Molecular Weight 236 aa, 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC020832
Gene Symbol RABL3
Gene ID (NCBI) 285282
RRIDAB_3672519
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ5HYI8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The gene of Rabl3 is located on 3q13.3 and is composed of eight exons and seven introns. It is a member of the Rab subfamily, the largest group in the Ras superfamily of small guanosine triphosphatases (GTPases).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 RABL3 antibody CL488-11916Download protocol
IF protocol for CL Plus 488 RABL3 antibody CL488-11916Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...