CoraLite® Plus 488-conjugated RBP4 Monoclonal antibody

RBP4 Monoclonal Antibody for IF/ICC, IF-P
Cat No. CL488-66104
Clone No.1D12B11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, IF-P

Plasma retinol-binding protein(1-181), Plasma retinol-binding protein(1-179), Plasma retinol-binding protein(1-176), Plasma retinol-binding protein, Plasma retinol binding protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66104 targets RBP4 in IF/ICC, IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19295

Product name: Recombinant human RBP4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-201 aa of BC020633

Sequence: MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Predict reactive species
Full Name retinol binding protein 4, plasma
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC020633
Gene Symbol RBP4
Gene ID (NCBI) 5950
RRIDAB_2919286
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02753
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents prevent kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RBP4 antibody CL488-66104Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...