APC-conjugated calreticulin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APC-conjugated calreticulin Polyclonal antibody (APC-27298)

• Featured Product
• KD/KO Validated

calreticulin Polyclonal Antibody for IF/ICC

Cat No. APC-27298

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

CALR, Calregulin, CRT

• 

  IF Staining of U2OS using APC-27298

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using APC calreticulin antibody (APC-27298) at dilution of 1:200, CL488-Phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-27298 targets calreticulin in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26064

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-417 aa of BC002500

  Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27797
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 60 kD by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.