• Featured Product
  • KD/KO Validated

MPO Monoclonal antibody

MPO Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 66177-1-Ig
Clone No.4C11F6

Host / Isotype

Mouse / IgA

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

4C11F6, EC:1.11.2.2, myeloperoxidase

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells
Positive IHC detected inhuman liver tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive IF/ICC detected inHL-60 cells
Positive FC (Intra) detected inHL-60 cells

Not recommend for IHC about rat sample. Mouse monoclonal antibodies of IgA isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66177-1-Ig targets MPO in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, rat, bovine, cow
Host / Isotype Mouse / IgA
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17564

Product name: Recombinant human MPO protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 606-657 aa of BC130476

Sequence: CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRV

Predict reactive species
Full Name myeloperoxidase
Calculated Molecular Weight 745 aa, 84 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC130476
Gene Symbol MPO
Gene ID (NCBI) 4353
RRIDAB_2881572
Conjugate Unconjugated
FormLiquid
Purification MethodCaprylic acid/ammonium sulfate precipitation
UNIPROT IDP05164
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The MPO gene encodes myeloperoxidase, a lysosomal hemoprotein located in the azurophilic granules of polymorphonuclear (PMN) leukocytes and monocytes. In response to stimulation, MPO is activated into a transient intermediate with potent antimicrobial oxidizing abilities(PMID:17650507). The mRNA is translated into a single protein of 90 kDa, which displays enzymatic activity and undergoes proteolytic maturation into a heavy chain of 59 kDa and a light chain of 13.5 kDa; these subunits then dimerize into the mature tetramer and the mature MPO is a heterotetramer composed of two identical heavy chains and two identical light chains(PMID:12773517). Fragments with molecular masses of 43-47 kDa were formed by autocatalysis during warming in sample buffer (PMID:12960244). The 24-kDa material had a map identical to that of 13.5 kDa subunit and represents a dimer of the 13.5 kDa subunit (PMID:3008892). Defects in MPO are the cause of myeloperoxidase deficiency (MPOD). It has 3 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for MPO antibody 66177-1-IgDownload protocol
IHC protocol for MPO antibody 66177-1-IgDownload protocol
IF protocol for MPO antibody 66177-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

Nat Commun

Overcoming therapeutic resistance in oncolytic herpes virotherapy by targeting IGF2BP3-induced NETosis in malignant glioma

Authors - Weiwei Dai
ratIF

Cell Death Differ

NLRX1 mediated impaired microglial phagocytosis of NETs in cerebral ischemia and reperfusion injury

Authors - Jialing Peng

PLoS Pathog

Prion protein signaling induces M2 macrophage polarization and protects from lethal influenza infection in mice.

Authors - Junji Chida
IHC

Int Immunopharmacol

Sappanone A enhances hepatocyte proliferation in lipopolysaccharide-induced acute liver injury in mice by promoting injured hepatocyte apoptosis and regulating macrophage polarization

Authors - Jiale He
IF

FEBS J

A combined model of serum neutrophil extracellular traps, CD8+ T cells, and tumor proportion score provides better prediction of PD-1 inhibitor efficacy in patients with NSCLC

Authors - Jian Guo
humanIHC

Sci Rep

Persisting and Increasing Neutrophil Infiltration Associates with Gastric Carcinogenesis and E-cadherin Downregulation.

Authors - Hualin Fu
Loading...
||
New chat Able
正在加载,请稍候...