Tested Applications
| Positive WB detected in | pig brain tissue, rat brain tissue, mouse brain tissue, Jurkat cells, K-562 cells |
| Positive IHC detected in | human prostate hyperplasia tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66921-1-Ig targets PTGER4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19262 Product name: Recombinant human PTGER4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 333-488 aa of BC101534 Sequence: RKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI Predict reactive species |
| Full Name | prostaglandin E receptor 4 (subtype EP4) |
| Calculated Molecular Weight | 488 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC101534 |
| Gene Symbol | PTGER4 |
| Gene ID (NCBI) | 5734 |
| RRID | AB_2882248 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35408 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTGER4 (Prostaglandin E2 receptor EP4 subtype, also known as EP4R) is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PTGER4 antibody 66921-1-Ig | Download protocol |
| IF protocol for PTGER4 antibody 66921-1-Ig | Download protocol |
| IHC protocol for PTGER4 antibody 66921-1-Ig | Download protocol |
| WB protocol for PTGER4 antibody 66921-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PTGER4 Monoclonal antibody (4A2A12), catalog number 66921-1-Ig, has 6 citations published in Signal Transduction and Targeted Therapy, Cell Metabolism, Nature Neuroscience, Nature Communications, Journal of Molecular Medicine, and Scientific Reports. The research spans innate immunity and neutrophil migration, metabolic regulation of insulin sensitivity, neuroprotection in prion disease, tissue immunity in pneumonia, ductus arteriosus closure, and renal ischemic injury. Applications cited include WB and IHC in mouse and human samples.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther m6A demethylase ALKBH5 is required for antibacterial innate defense by intrinsic motivation of neutrophil migration. | ||
Cell Metab m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 | ||
Nat Neurosci NG2 glia protect against prion neurotoxicity by inhibiting microglia-to-neuron prostaglandin E2 signaling | ||
Nat Commun Post-resolution macrophages shape long-term tissue immunity and integrity in a mouse model of pneumococcal pneumonia | ||
J Mol Med (Berl) Vav2 promotes ductus arteriosus anatomic closure via the remodeling of smooth muscle cells by Rac1 activation | ||
Sci Rep Prostaglandin E2 receptor EP4 activation induces tolerogenic dendritic cells to mitigate ischemic acute kidney injury |























