• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Fascin Monoclonal antibody

Fascin Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL488-66321
Clone No.1B5G3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF-P, FC (Intra)

FSCN1, Fascin 1,Fascin, FAN1, 55 kDa actin-bundling protein, 55 kDa actin bundling protein

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue
Positive FC (Intra) detected inHeLa cells, SH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66321 targets Fascin in IF-P, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6074

Product name: Recombinant human Fascin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-187 aa of BC000521

Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS

Predict reactive species
Full Name fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
Calculated Molecular Weight 55 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC000521
Gene Symbol Fascin
Gene ID (NCBI) 6624
ENSEMBL Gene IDENSG00000075618
RRIDAB_2883308
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16658
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Fascin antibody CL488-66321Download protocol
FC protocol for CL Plus 488 Fascin antibody CL488-66321Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...