CoraLite®594-conjugated Fascin Monoclonal antibody

• 

  IF Staining of human tonsillitis using CL594-66321

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CL594-66321 (Fascin antibody) at dilution of 1:100.

• 

  IF Staining of human tonsillitis using CL594-66321

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CL594-66321 (Fascin antibody) at dilution of 1:100.

• 

  FC experiment of HeLa using CL594-66321

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug CoraLite®594 Anti-Human Fascin (CL594-66321, Clone:1B5G3) (red), or 0.2 ug Mouse IgG2a Isotype Control (CL594-66360-2, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Fascin Monoclonal Antibody for IF-P, FC (Intra)

Cat No. CL594-66321

Clone No.1B5G3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF-P, FC (Intra)

Synonyms

FSCN1, Fascin 1,Fascin, FAN1, 55 kDa actin-bundling protein, 55 kDa actin bundling protein

---

Tested Applications

• Positive IF-P detected in: human tonsillitis tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66321 targets Fascin in IF-P, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6074

  Product name: Recombinant human Fascin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC000521

  Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS

• Full Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
• Calculated Molecular Weight: 55 kDa
• GenBank Accession Number: BC000521
• Gene Symbol: Fascin
• Gene ID (NCBI): 6624
• ENSEMBL Gene ID: ENSG00000075618
• RRID: AB_2883557
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16658
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.