"Lamin B1 Antibodies" Comparison
View side-by-side comparison of Lamin B1 antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | NCI-H1299 cells, multi-cells/tissue, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, 4T1cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66095-1-Ig targets Lamin B1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, canine, monkey, chicken, zebrafish, hamster |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20522 Product name: Recombinant human Lamin B1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 237-587 aa of BC012295 Sequence: EYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM Predict reactive species |
| Full Name | lamin B1 |
| Calculated Molecular Weight | 66 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC012295 |
| Gene Symbol | Lamin B1 |
| Gene ID (NCBI) | 4001 |
| ENSEMBL Gene ID | ENSG00000113368 |
| RRID | AB_11232208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P20700 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lamins are components of the nuclear lamina, a fibrous layer on the nucleoplasmic side of the inner nuclear membrane, which is thought to provide a framework for the nuclear envelope and may also interact with chromatin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. This protein is not suitable for samples where the nuclear envelope has been removed.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IF protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IHC protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| IP protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| WB protocol for Lamin B1 antibody 66095-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Lamin B1 Monoclonal antibody (3C10G12), catalog number 66095-1-Ig, has 588 citations. These appear in journals including Cell, Nature Communications, Nature Cell Biology, Molecular Cell, Immunity, Cell Metabolism, Nature Structural & Molecular Biology, EMBO Journal, PNAS, Neuron, and Nature Chemical Biology. Associated research fields span oncology, cell biology, immunology, metabolism, neuroscience, cardiology, liver disease, DNA repair, RNA modification, autophagy, stem cell biology, aging, and vascular biology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Novel nuclear RNA export factor 1 adaptor drives tumor growth by increasing proliferation-stimulatory mRNA export | ||
Signal Transduct Target Ther PUMA facilitates EMI1-promoted cytoplasmic Rad51 ubiquitination and inhibits DNA repair in stem and progenitor cells. | ||
Signal Transduct Target Ther Gut dysbiosis conveys psychological stress to activate LRP5/β-catenin pathway promoting cancer stemness | ||
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. |
Reviews
What customers say
The 12 reviews for 66095-1-Ig are overwhelmingly positive, with 7 out of 12 giving 5 stars. Most users applied it for Western Blot, reporting a clear ~70 kDa Lamin B1 band and recommending it as a reliable internal control. Dilutions ranged from 1:250 to 1:5000 across various cell lines and tissues. A few minor concerns were noted: one user observed higher non-specific bands in mouse heart, and another reported elevated nuclear background in immunofluorescence staining. Overall, reviewers consistently praised its specificity and performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (09-16-2026) | Great antibody used for Western-Blot with 10µg of protein extracts and an 1h incubation at room temperature!
|
Mariana (Verified Customer) (07-20-2026) | The antibody worked very well.
|
Nurit (Verified Customer) (02-16-2026) | We used this antibody for western blotting of human iPSC-derived astrocytes (Rett syndrome patient) and it worked great. In the image, Lamin B1 is in green (red is unrelated p62)
 |
Echo (Verified Customer) (10-03-2024) | Quality great
 |
PK (Verified Customer) (08-14-2024) | Excellent
 |
S (Verified Customer) (12-12-2022) |
 |
WEI (Verified Customer) (03-08-2022) | Specfic bands around predicted size with higher non-specific bands
|
P. (Verified Customer) (05-15-2021) | Good antibody!
 |
Eiko (Verified Customer) (11-18-2020) | Used RIPA buffer for western sample preparation, and 5% Skim milk TBS-T was used for blocking and antibody dilution.Since I could see clear lamin B1 signal, I am happy to use this antibody as one of my internal controls.
|
Tom (Verified Customer) (10-09-2020) | I observed a discrete ~70kDa Lamin B1 band using this antibody.
|
Yuan (Verified Customer) (12-13-2019) | Did staining for human A549 cell.The Lamin B antibody had high background in nucleus. Please see attached image.
 |
Shubham (Verified Customer) (03-14-2019) | good
 |
