Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Caldesmon Monoclonal antibody

Caldesmon Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-66693
Clone No.1E1C11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

CALD1, 1E1C11, CAD, caldesmon 1, CDM

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66693 targets Caldesmon in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13676

Product name: Recombinant human CALD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 196-538 aa of BC040354

Sequence: EKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQNGEFMTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV

Predict reactive species
Full Name caldesmon 1
Calculated Molecular Weight 538 aa, 63 kDa
Observed Molecular Weight 70 kDa~75 kDa
GenBank Accession NumberBC040354
Gene Symbol CALD1
Gene ID (NCBI) 800
RRIDAB_2883614
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ05682
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Caldesmon (CALD1), a protein found in the cytoskeleton, plays an important role in proliferation, apoptosis, cell motility, adhesion, receptor function, and second messenger pathways. Caldesmon is a substrate of cdc2 kinase and Erk1/2 MAPK, and phosphorylation by either of these kinases reverses the inhibitory effects of caldesmon. Caldesmon(CALD1) is a prognostic biomarker and correlated with bladder cancer(PMID: 34733993) and immune infiltrates in gastric cancers(PMID: 34189308).

Protocols

Product Specific Protocols
FC protocol for CL594 Caldesmon antibody CL594-66693Download protocol
IF protocol for CL594 Caldesmon antibody CL594-66693Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...