Recombinant human CD45 protein

Name: Recombinant human CD45 protein
Brand: Proteintech
SKU: Ag31286

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag31286

Synonyms

CD45, EC:3.1.3.48, GP180, L CA, LCA

Overview

Product Information
Reconstitution and Storage
Related Products (100)

Print datasheet

MSDS

Validation Data Gallery View All

CD45 fusion protein Ag31286 SDS-PAGE

-/ -

Cat No. Ag31286

Freight/Packing: -

Country/Region

Size

Quantity

Please visit your regions distributor:

Request bulk or custom quote

Product Information

Peptide Sequence	TPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKD (172-493 aa encoded by BC014239)
Activity	Not tested.
Endotoxin Level	Please contact the lab for more information.
Formulation	The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Shipping and Storage

Reconstitution	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping	The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability and Storage	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage of Reconstituted Protein	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

Recombinant human CD45 protein

Validation Data Gallery View All

CD45 fusion protein Ag31286 SDS-PAGE

Product Information

Shipping and Storage

Related Products

CoraLite®594 Anti-Human CD45 Rabbit Recombinant Antibody

CoraLite® Plus 488-conjugated CD45 Recombinant antibody

CD45 Polyclonal antibody

CD45 Polyclonal antibody

CoraLite® Plus 647 Anti-Human CD45 Rabbit Recombinant Antibody

CoraLite® Plus 488 Anti-Human CD45 Rabbit Recombinant Antibody

CoraLite® Plus 488-conjugated CD45 Monoclonal antibody

Anti-Human CD45RO (UCHL1) Mouse IgG2a Recombinant Antibody

Anti-Human CD45RO (UCHL1) Mouse IgG2a Recombinant Antibody, PBS Only

MultiPro® 5CFLX Anti-Human CD45 (HI30)

MultiPro® 5CFLX Anti-Human CD45RA (F8-11-13)

Anti-Human CD45 Rabbit Recombinant Antibody, PBS Only

Anti-Human CD45 Rabbit Recombinant Antibody

CoraLite® Plus 647 Anti-Human CD45RO (UCHL1)

CoraLite® Plus 647 Anti-Human CD45RA (F8-11-13)

FcZero-rAb™ PE Anti-Human CD45 Rabbit Recombinant Antibody

PerCP Anti-Human CD45 (HI30)

CD45 Recombinant antibody, PBS Only

CD45 Recombinant antibody

CoraLite® Plus 555 Anti-Human CD45RA (F8-11-13)

CoraLite®555-conjugated CD45 Recombinant antibody

FITC Plus Anti-Human CD45RA (F8-11-13)

FITC Plus Anti-Human CD45 Rabbit Recombinant Antibody

PE Anti-Human CD45RA (F8-11-13)

PE Anti-Human CD45RO (UCHL1) Mouse IgG2a Recombinant Antibody

PE Anti-Human CD45 Rabbit Recombinant Antibody

FcZero-rAb™ APC Anti-Human CD45 Rabbit Recombinant Antibody

APC-Cyanine7 Anti-Human CD45 Rabbit Recombinant Antibody

Biotin Anti-Human CD45 Rabbit Recombinant Antibody

Atlantic Blue™ Anti-Human CD45RA (HI100)

Atlantic Blue™ Anti-Human CD45 (HI30)

Atlantic Blue™ Anti-Human CD45RA (F8-11-13)

CoraLite® Plus 647 Anti-Human CD45 (2D1)

CoraLite® Plus 647 Anti-Human CD45RA (HI100)

CoraLite® Plus 647 Anti-Human CD45 (HI30)

CoraLite®555-conjugated CD45 Monoclonal antibody

CoraLite® Plus 555 Anti-Human CD45RA (HI100)

CoraLite® Plus 555 Anti-Human CD45 (HI30)

CoraLite® Plus 555 Anti-Human CD45RO (UCHL1)

CoraLite® Plus 750 Anti-Human CD45RA (HI100)

CoraLite® Plus 750 Anti-Human CD45 (HI30)

CoraLite® Plus 750 Anti-Human CD45RO (UCHL1)

CoraLite® Plus 750 Anti-Human CD45RA (F8-11-13)

CoraLite® Plus 405 Anti-Human CD45 (HI30)

CoraLite® Plus 405 Anti-Human CD45RO (UCHL1)

CoraLite® Plus 405 Anti-Human CD45RA (F8-11-13)

CoraLite® Plus 405 Anti-Human CD45 Rabbit Recombinant Antibody

PE Anti-Human CD45 (2D1)

PE Anti-Human CD45RA (HI100)

PE Anti-Human CD45 (HI30)

PE Anti-Human CD45RO (UCHL1)

CoraLite® Plus 488 Anti-Human CD45 (2D1)

CoraLite® Plus 488 Anti-Human CD45RA (HI100)

CoraLite® Plus 488 Anti-Human CD45 (HI30)

CoraLite® Plus 488 Anti-Human CD45RO (UCHL1)

CoraLite® Plus 488 Anti-Human CD45RA (F8-11-13)

APC Anti-Human CD45RA (HI100)

APC Anti-Human CD45 (HI30)

APC Anti-Human CD45RO (UCHL1)

APC Anti-Human CD45RO (UCHL1) Mouse IgG2a Recombinant Antibody

APC Anti-Human CD45 Rabbit Recombinant Antibody

Cardinal Red™ Anti-Human CD45RA (F8-11-13)

FITC Plus Anti-Human CD45 (2D1)

FITC Plus Anti-Human CD45RA (HI100)

FITC Plus Anti-Human CD45 (HI30)

FITC Plus Anti-Human CD45RO (UCHL1)

CoraLite®594-conjugated CD45 Monoclonal antibody

CoraLite® Plus 594 Anti-Human CD45 (2D1)

CoraLite® Plus 594 Anti-Human CD45RA (HI100)

CoraLite®594 Anti-Human CD45 (HI30)

CoraLite® Plus 594 Anti-Human CD45RO (UCHL1)

CoraLite® Plus 594 Anti-Human CD45RA (F8-11-13)

CD45(220-577) Recombinant antibody, PBS Only (Detector)

CD45(220-577) Recombinant antibody, PBS Only (Capture/Detector)